NCBI的原链接：
NM_001159598另存为文件 GenBank格式 Fasta格式 NT+CDS区的氨基酸序列 CDS区的ORF序列 CDS区的氨基酸序列 UTR序列
LOCUS NM_001159598 3671 bp mRNA linear ROD 08-AUG-2010
DEFINITION Mus musculus axin 1 (Axin1), transcript variant 1, mRNA.
ACCESSION NM_001159598
VERSION NM_001159598.1 GI:227430348
KEYWORDS .
SOURCE Mus musculus (house mouse)
ORGANISM Mus musculus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;
Sciurognathi; Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE 1 (bases 1 to 3671)
AUTHORS Shimogori,T., Lee,D.A., Miranda-Angulo,A., Yang,Y., Wang,H.,
Jiang,L., Yoshida,A.C., Kataoka,A., Mashiko,H., Avetisyan,M.,
Qi,L., Qian,J. and Blackshaw,S.
TITLE A genomic atlas of mouse hypothalamic development
JOURNAL Nat. Neurosci. 13 (6), 767-775 (2010)
PUBMED 20436479
REFERENCE 2 (bases 1 to 3671)
AUTHORS Rosenfeld,C.S.
TITLE Animal models to study environmental epigenetics
JOURNAL Biol. Reprod. 82 (3), 473-488 (2010)
PUBMED 19828779
REMARK Review article
REFERENCE 3 (bases 1 to 3671)
AUTHORS Dao,D.Y., Yang,X., Flick,L.M., Chen,D., Hilton,M.J. and
O'Keefe,R.J.
TITLE Axin2 regulates chondrocyte maturation and axial skeletal
development
JOURNAL J. Orthop. Res. 28 (1), 89-95 (2010)
PUBMED 19623616
REFERENCE 4 (bases 1 to 3671)
AUTHORS Li,Q., Lin,S., Wang,X., Lian,G., Lu,Z., Guo,H., Ruan,K., Wang,Y.,
Ye,Z., Han,J. and Lin,S.C.
TITLE Axin determines cell fate by controlling the p53 activation
threshold after DNA damage
JOURNAL Nat. Cell Biol. 11 (9), 1128-1134 (2009)
PUBMED 19731416
REMARK GeneRIF: Axin is a critical determinant in p53-dependent tumour
suppression in which Pirh2 and Tip60 have different roles in
triggering cell-cycle arrest or apoptosis depending on the severity
of genotoxic stress.
Erratum:[Nat Cell Biol. 2009 Oct;11(10):1272]
REFERENCE 5 (bases 1 to 3671)
AUTHORS Jiang,Y., Luo,W. and Howe,P.H.
TITLE Dab2 stabilizes Axin and attenuates Wnt/beta-catenin signaling by
preventing protein phosphatase 1 (PP1)-Axin interactions
JOURNAL Oncogene 28 (33), 2999-3007 (2009)
PUBMED 19581931
REMARK GeneRIF: Dab2 stabilizes Axin and attenuates Wnt/beta-catenin
signaling by preventing PP1 from binding Axin
REFERENCE 6 (bases 1 to 3671)
AUTHORS Ebersole,T., Lai,F. and Artzt,K.
TITLE New molecular markers for the distal end of the t-complex and their
relationships to mutations affecting mouse development
JOURNAL Genetics 131 (1), 175-182 (1992)
PUBMED 1350556
REFERENCE 7 (bases 1 to 3671)
AUTHORS Ruvinsky,A.O. and Agulnik,A.I.
TITLE Gametic imprinting and the manifestation of the fused gene in the
house mouse
JOURNAL Dev. Genet. 11 (4), 263-269 (1990)
PUBMED 2090373
REFERENCE 8 (bases 1 to 3671)
AUTHORS Lyon,M.F. and Bechtol,K.B.
TITLE Derivation of mutant t-haplotypes of the mouse by presumed
duplication or deletion
JOURNAL Genet. Res. 30 (1), 63-76 (1977)
PUBMED 924142
REFERENCE 9 (bases 1 to 3671)
AUTHORS Key,M. and Hollander,W.F.
TITLE Thin fur, a recessive mutant on chromosome 17 of the mouse
JOURNAL J. Hered. 63 (2), 97-98 (1972)
PUBMED 5031320
REFERENCE 10 (bases 1 to 3671)
AUTHORS Deol,M.S.
TITLE The probable mode of gene action in the circling mutants of the
mouse
JOURNAL Genet. Res. 7 (3), 363-371 (1966)
PUBMED 5940872
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AC140047.8 and AC126438.3.
Transcript Variant: This variant (1) represents the shorter
transcript and encodes the shorter isoform (1).
Sequence Note: The RefSeq transcript and protein were derived from
genomic sequence to make the sequence consistent with the reference
genome assembly. The genomic coordinates used for the transcript
record were based on alignments.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the
Entrez Gene record to access additional publications.
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-48 AC140047.8 158323-158370
49-356 AC140047.8 158371-158678
357-1315 AC140047.8 162255-163213
1316-1456 AC126438.3 131472-131612 c
1457-1553 AC126438.3 122666-122762 c
1554-1691 AC126438.3 120938-121075 c
1692-2209 AC126438.3 117031-117548 c
2210-2380 AC126438.3 116508-116678 c
2381-2626 AC126438.3 115021-115266 c
2627-2794 AC126438.3 111146-111313 c
2795-3671 AC126438.3 109441-110317 c
FEATURES Location/Qualifiers
source 1..3671
/organism="Mus musculus"
/mol_type="mRNA"
/db_xref="taxon:10090"
/chromosome="17"
/map="17 11.8 cM"
gene 1..3671
/gene="Axin1"
/gene_synonym="AI316800; Axin; Fu; fused; Kb; Ki; kinky;
knobbly; MGC132911"
/note="axin 1"
/db_xref="GeneID:12005"
/db_xref="MGI:1096327"
exon 1..356
/gene="Axin1"
/gene_synonym="AI316800; Axin; Fu; fused; Kb; Ki; kinky;
knobbly; MGC132911"
/inference="alignment:Splign"
/number=1
exon 357..1315
/gene="Axin1"
/gene_synonym="AI316800; Axin; Fu; fused; Kb; Ki; kinky;
knobbly; MGC132911"
/inference="alignment:Splign"
/number=2
CDS 423..2921
/gene="Axin1"
/gene_synonym="AI316800; Axin; Fu; fused; Kb; Ki; kinky;
knobbly; MGC132911"
/note="isoform 1 is encoded by transcript variant 1;
protein Fused; axis inhibition protein 1; axin-1"
/codon_start=1
/product="axin-1 isoform 1"
/protein_id="NP_001153070.1"
/db_xref="GI:227430349"
/db_xref="GeneID:12005"
/db_xref="MGI:1096327"
/translation="MQSPKMNVQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDSRP
VNHSFCSGKGTSIKSETSTATPRRSDLDLGYEPEGSASPTPPYLRWAESLHSLLDDQD
GISLFRTFLKQEGCADLLDFWFACSGFRKLEPCDSNEEKRLKLARAIYRKYILDSNGI
VSRQTKPATKSFIKDCVMKQQIDPAMFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRT
GSESPKVCSDQSSGSGTGKGMSGYLPTLNEDEEWKCDQDADEDDGRDPLPPSRLTQKL
LLETAAPRAPSSRRYNEGRELRYGSWREPVNPYYVNSGYALAPATSANDSEQQSLSSD
ADTLSLTDSSVDGIPPYRIRKQHRREMQESIQVNGRVPLPHIPRTYRMPKEIRVEPQK
FAEELIHRLEAVQRTREAEEKLEERLKRVRMEEEGEDGEMPSGPMASHKLPSVPAWHH
FPPRYVDMGCSGLRDAHEENPESILDEHVQRVMRTPGCQSPGPGHRSPDSGHVAKTAV
LGGTASGHGKHVPKLGLKLDTAGLHHHRHVHHHVHHNSARPKEQMEAEVARRVQSSFS
WGPETHGHAKPRSYSENAGTTLSAGDLAFGGKTSAPSKRNTKKAESGKNANAEVPSTT
EDAEKNQKIMQWIIEGEKEISRHRKAGHGSSGLRKQQAHESSRPLSIERPGAVHPWVS
AQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRLEEEEKRANKLPSKQRTKSQR
KAGGGSAPPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVS
DEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD"
STS 424..1081
/gene="Axin1"
/gene_synonym="AI316800; Axin; Fu; fused; Kb; Ki; kinky;
knobbly; MGC132911"
/standard_name="PMC134648P1"
/db_xref="UniSTS:270734"
exon 1316..1456
/gene="Axin1"
/gene_synonym="AI316800; Axin; Fu; fused; Kb; Ki; kinky;
knobbly; MGC132911"
/inference="alignment:Splign"
/number=3
exon 1457..1553
/gene="Axin1"
/gene_synonym="AI316800; Axin; Fu; fused; Kb; Ki; kinky;
knobbly; MGC132911"
/inference="alignment:Splign"
/number=4
exon 1554..1691
/gene="Axin1"
/gene_synonym="AI316800; Axin; Fu; fused; Kb; Ki; kinky;
knobbly; MGC132911"
/inference="alignment:Splign"
/number=5
STS 1646..2612
/gene="Axin1"
/gene_synonym="AI316800; Axin; Fu; fused; Kb; Ki; kinky;
knobbly; MGC132911"
/standard_name="Axin1"
/db_xref="UniSTS:527270"
exon 1692..2209
/gene="Axin1"
/gene_synonym="AI316800; Axin; Fu; fused; Kb; Ki; kinky;
knobbly; MGC132911"
/inference="alignment:Splign"
/number=6
exon 2210..2380
/gene="Axin1"
/gene_synonym="AI316800; Axin; Fu; fused; Kb; Ki; kinky;
knobbly; MGC132911"
/inference="alignment:Splign"
/number=7
exon 2381..2626
/gene="Axin1"
/gene_synonym="AI316800; Axin; Fu; fused; Kb; Ki; kinky;
knobbly; MGC132911"
/inference="alignment:Splign"
/number=8
exon 2627..2794
/gene="Axin1"
/gene_synonym="AI316800; Axin; Fu; fused; Kb; Ki; kinky;
knobbly; MGC132911"
/inference="alignment:Splign"
/number=10
exon 2795..3671
/gene="Axin1"
/gene_synonym="AI316800; Axin; Fu; fused; Kb; Ki; kinky;
knobbly; MGC132911"
/inference="alignment:Splign"
/number=11
STS 3178..3299
/gene="Axin1"
/gene_synonym="AI316800; Axin; Fu; fused; Kb; Ki; kinky;
knobbly; MGC132911"
/standard_name="AF009011"
/db_xref="UniSTS:180980"
STS 3277..3469
/gene="Axin1"
/gene_synonym="AI316800; Axin; Fu; fused; Kb; Ki; kinky;
knobbly; MGC132911"
/standard_name="RH136120"
/db_xref="UniSTS:210115"
STS 3533..3646
/gene="Axin1"
/gene_synonym="AI316800; Axin; Fu; fused; Kb; Ki; kinky;
knobbly; MGC132911"
/standard_name="RH44784"
/db_xref="UniSTS:28633"
ORIGIN
1 gcacttccgg gcggcgccgg cgggggcgct caggcctggg cttcagggct ctgggctcag
61 gctcccggct cagggaagcg cttgcggccg ccgccgcagg agcctgctgg ggtcgggctg
121 gagcctggtt ccagagaggg ctggtgagag tgagcagccg gttttggcgg cgctctgcgg
181 cctgccttgc gccgcctccg ggccacgggt cgccgagccg ccgccgccgc cgcgatgggg
241 gccccccagg gccgcgcccc cgccgtggcc cgcccgctga gccgccgctg agcgcatggg
301 cctcgccggg ccgggagcca ggccccgggc cgcgcctcca cagccgccgc gcgctggaga
361 gattgattcc cttgggagct gtaagtactg aggtattagg gtgcagcgct cattgttcac
421 tgatgcagag tcccaaaatg aatgtccagg agcagggttt ccccttggac ctcggagcaa
481 gtttcaccga agatgccccc cggcccccag tgcctggaga agagggagaa ctggtatcta
541 ctgattcgag gcctgtcaac cacagtttct gttctgggaa aggtaccagc attaaaagtg
601 agacctcaac agccacccca agacgttcag atctggatct gggatatgag cccgagggca
661 gtgcctcccc caccccacca tatttgaggt gggctgagtc actgcattcc ttactggatg
721 accaagatgg gatcagcctg ttcaggactt tcctgaagca ggagggctgt gctgacctgc
781 tggacttctg gtttgcctgc agtggcttca ggaagcttga gccctgtgac tcaaatgagg
841 aaaagaggct gaagctggca agagccatct accgaaagta catcctggat agcaatggca
901 ttgtgtccag acaaaccaag ccagccacta agagcttcat aaaggactgt gtcatgaagc
961 agcagataga tcctgccatg tttgaccagg cacagacaga aatccagtcc accatggagg
1021 agaataccta cccttccttt cttaagtctg acatttattt ggagtacaca aggacaggct
1081 cagagagtcc gaaggtctgc agtgaccaga gctcagggtc tggaacaggg aagggcatgt
1141 ctggatacct gcccactttg aatgaggatg aagaatggaa atgtgaccaa gatgcagatg
1201 aggatgatgg ccgagaccct ctccccccca gcaggctcac ccagaagctg ctattggaga
1261 ctgctgcccc gagggccccc tcaagtagac ggtacaacga aggcagagag ctcaggtatg
1321 gatcttggag ggagcccgtc aacccctact acgtcaactc tggctatgcc ctggccccag
1381 ccaccagtgc caatgacagt gagcagcaga gcctgtccag tgatgctgac acgctatccc
1441 ttacggacag tagtgtggat ggaatccccc catacaggat ccgtaagcag caccgaaggg
1501 agatgcagga gagtatccaa gtcaatgggc gggtacctct acctcacatt cctcgcactt
1561 accgaatgcc aaaggagatc cgggtagagc cacagaaatt tgctgaagag cttattcacc
1621 gtctagaggc tgtccagcgc actcgagagg ctgaagaaaa gttggaggaa cggctgaagc
1681 gtgtacgcat ggaggaagaa ggggaggatg gtgaaatgcc ttctggcccc atggcaagtc
1741 acaagctgcc ttctgtccca gcttggcacc atttcccacc ccgctatgtg gatatgggct
1801 gctctggact gcgggatgcc catgaggaga atcctgagag catcctggat gagcacgtgc
1861 aaagggtcat gaggacacct ggctgccagt cacctggccc aggccaccgc tctcctgaca
1921 gtgggcatgt ggctaagact gcagtgctag ggggtacagc ctccgggcat gggaagcatg
1981 ttcctaagtt agggttgaag ctggatacag ctggcctgca ccatcataga catgtccacc
2041 accatgttca ccataattca gctagaccta aggagcaaat ggaggctgaa gttgcccgca
2101 gggtccagag cagcttctcg tggggcccag aaacacatgg tcatgccaag ccccggagct
2161 attccgagaa cgcaggcacc accctcagtg ctggggattt ggcctttggt ggtaaaacta
2221 gtgcaccttc caaaagaaac accaagaagg ctgaatctgg gaagaatgcc aatgctgagg
2281 tacccagtac cacagaggac gctgagaaga accagaagat catgcagtgg atcattgagg
2341 gagagaagga gatcagtaga caccggaagg caggccatgg gtcttctggg ttgaggaagc
2401 agcaggccca tgaaagctcc aggcccttgt ccatcgagcg tcctggggcc gtgcacccct
2461 gggtcagcgc tcagcttcgg aattctgtcc agccttctca tcttttcatc caagatccca
2521 caatgccacc caatccagcc cctaatcccc tgacccagct ggaagaggcc cgcaggcgtt
2581 tggaagaaga agaaaagaga gcaaacaaac tgccctccaa gcagaggaca aaatcacaaa
2641 gaaaggcagg tggcgggagt gcaccaccat gtgacagcat tgttgtggcc tactatttct
2701 gtggggaacc catcccctac cggaccctgg tgaggggccg tgctgtcacc ctgggccagt
2761 tcaaggagct gctaaccaag aaggggagct acagatacta ctttaagaaa gtgagtgatg
2821 agtttgactg tggtgtggta tttgaggaag tacgggagga tgaggccgtc ttgcctgtct
2881 ttgaagaaaa gatcatcggc aaggtggaaa aggtggactg agcactgggc agcacacccg
2941 gagcacacca tcactactgt gcactgtcat cagtcaggtg gacagccttg tcctcaggag
3001 cctggtgtgg ggaacaacac aagattgtgt catgagctct tctatcgggg tgaggctggg
3061 gaccttaggt gtctgccagc ctctgtccct ctggctttgg gaaagtgggg gtggggggtc
3121 gtcctactga gtggttcctt gggtttctct gttttgctgt tcaagaggaa agttccactt
3181 accaccacat taccccctga agcaatacca ggagccatct catgaccctc agcagctctt
3241 gcttctgaat ccagtctgac ctagggatac tttgccctgg gcttgtatcc cactgtcctc
3301 ttctctctct ctgggaccta tccactgcac ctggttgggc tcaggtccag gagcagggga
3361 tcctgtgggg gcctctatat attgtacatg tcactgagtg ccttcaacat agctgtctct
3421 tgcctgccac tgtgtgaatc tggcagctga gtatctcagg cccctttgcc tgtctctagc
3481 caccagcttg gttcagcagg agggggggcg gtgtgtctgg tcccttccaa gtgtccgtgt
3541 aaatatgtac atttctcagg ccagggccag cagggggata ccctgagccc atttttcatg
3601 caatgacttg tacaattatc ttttcaaagg tacttggata ataatgaaat aaaaacgttt
3661 ttgaaccttc c
//