NCBI的原链接：
NM_014576另存为文件 GenBank格式 Fasta格式 NT+CDS区的氨基酸序列 CDS区的ORF序列 CDS区的氨基酸序列 UTR序列
LOCUS NM_014576 2128 bp mRNA linear PRI 25-APR-2010
DEFINITION Homo sapiens APOBEC1 complementation factor (A1CF), transcript
variant 1, mRNA.
ACCESSION NM_014576
VERSION NM_014576.2 GI:20357571
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2128)
AUTHORS Galloway,C.A. and Smith,H.C.
TITLE The expression of apoB mRNA editing factors is not the sole
determinant for the induction of editing in differentiating Caco-2
cells
JOURNAL Biochem. Biophys. Res. Commun. 391 (1), 659-663 (2010)
PUBMED 19932086
REMARK GeneRIF: The data presented in this report suggested that similar
regulatory mechanisms controlling the functional interaction of
APOBEC-1 with ACF might be operational during enterocyte
differentiation.
REFERENCE 2 (bases 1 to 2128)
AUTHORS Blanc,V., Henderson,J.O., Newberry,E.P., Kennedy,S., Luo,J. and
Davidson,N.O.
TITLE Targeted deletion of the murine apobec-1 complementation factor
(acf) gene results in embryonic lethality
JOURNAL Mol. Cell. Biol. 25 (16), 7260-7269 (2005)
PUBMED 16055734
REMARK GeneRIF: ACF plays a crucial role, which is independent of apobec-1
expression, in cell survival, particularly during early embryonic
development
REFERENCE 3 (bases 1 to 2128)
AUTHORS Deloukas,P., Earthrowl,M.E., Grafham,D.V., Rubenfield,M.,
French,L., Steward,C.A., Sims,S.K., Jones,M.C., Searle,S.,
Scott,C., Howe,K., Hunt,S.E., Andrews,T.D., Gilbert,J.G.,
Swarbreck,D., Ashurst,J.L., Taylor,A., Battles,J., Bird,C.P.,
Ainscough,R., Almeida,J.P., Ashwell,R.I., Ambrose,K.D.,
Babbage,A.K., Bagguley,C.L., Bailey,J., Banerjee,R., Bates,K.,
Beasley,H., Bray-Allen,S., Brown,A.J., Brown,J.Y., Burford,D.C.,
Burrill,W., Burton,J., Cahill,P., Camire,D., Carter,N.P.,
Chapman,J.C., Clark,S.Y., Clarke,G., Clee,C.M., Clegg,S., Corby,N.,
Coulson,A., Dhami,P., Dutta,I., Dunn,M., Faulkner,L., Frankish,A.,
Frankland,J.A., Garner,P., Garnett,J., Gribble,S., Griffiths,C.,
Grocock,R., Gustafson,E., Hammond,S., Harley,J.L., Hart,E.,
Heath,P.D., Ho,T.P., Hopkins,B., Horne,J., Howden,P.J., Huckle,E.,
Hynds,C., Johnson,C., Johnson,D., Kana,A., Kay,M., Kimberley,A.M.,
Kershaw,J.K., Kokkinaki,M., Laird,G.K., Lawlor,S., Lee,H.M.,
Leongamornlert,D.A., Laird,G., Lloyd,C., Lloyd,D.M., Loveland,J.,
Lovell,J., McLaren,S., McLay,K.E., McMurray,A.,
Mashreghi-Mohammadi,M., Matthews,L., Milne,S., Nickerson,T.,
Nguyen,M., Overton-Larty,E., Palmer,S.A., Pearce,A.V., Peck,A.I.,
Pelan,S., Phillimore,B., Porter,K., Rice,C.M., Rogosin,A.,
Ross,M.T., Sarafidou,T., Sehra,H.K., Shownkeen,R., Skuce,C.D.,
Smith,M., Standring,L., Sycamore,N., Tester,J., Thorpe,A.,
Torcasso,W., Tracey,A., Tromans,A., Tsolas,J., Wall,M., Walsh,J.,
Wang,H., Weinstock,K., West,A.P., Willey,D.L., Whitehead,S.L.,
Wilming,L., Wray,P.W., Young,L., Chen,Y., Lovering,R.C.,
Moschonas,N.K., Siebert,R., Fechtel,K., Bentley,D., Durbin,R.,
Hubbard,T., Doucette-Stamm,L., Beck,S., Smith,D.R. and Rogers,J.
TITLE The DNA sequence and comparative analysis of human chromosome 10
JOURNAL Nature 429 (6990), 375-381 (2004)
PUBMED 15164054
REFERENCE 4 (bases 1 to 2128)
AUTHORS Xie,K., Sowden,M.P., Dance,G.S., Torelli,A.T., Smith,H.C. and
Wedekind,J.E.
TITLE The structure of a yeast RNA-editing deaminase provides insight
into the fold and function of activation-induced deaminase and
APOBEC-1
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 101 (21), 8114-8119 (2004)
PUBMED 15148397
REMARK GeneRIF: results suggested both AID and APOBEC-1 are equally likely
to bind single-stranded DNA or RNA, which has implications for the
identification of natural AID targets
REFERENCE 5 (bases 1 to 2128)
AUTHORS Blanc,V., Kennedy,S. and Davidson,N.O.
TITLE A novel nuclear localization signal in the auxiliary domain of
apobec-1 complementation factor regulates nucleocytoplasmic import
and shuttling
JOURNAL J. Biol. Chem. 278 (42), 41198-41204 (2003)
PUBMED 12896982
REFERENCE 6 (bases 1 to 2128)
AUTHORS Blanc,V., Navaratnam,N., Henderson,J.O., Anant,S., Kennedy,S.,
Jarmuz,A., Scott,J. and Davidson,N.O.
TITLE Identification of GRY-RBP as an apolipoprotein B RNA-binding
protein that interacts with both apobec-1 and apobec-1
complementation factor to modulate C to U editing
JOURNAL J. Biol. Chem. 276 (13), 10272-10283 (2001)
PUBMED 11134005
REFERENCE 7 (bases 1 to 2128)
AUTHORS Chester,A., Scott,J., Anant,S. and Navaratnam,N.
TITLE RNA editing: cytidine to uridine conversion in apolipoprotein B
mRNA
JOURNAL Biochim. Biophys. Acta 1494 (1-2), 1-13 (2000)
PUBMED 11072063
REMARK Review article
REFERENCE 8 (bases 1 to 2128)
AUTHORS Yang,Y., Sowden,M.P. and Smith,H.C.
TITLE Induction of cytidine to uridine editing on cytoplasmic
apolipoprotein B mRNA by overexpressing APOBEC-1
JOURNAL J. Biol. Chem. 275 (30), 22663-22669 (2000)
PUBMED 10833526
REFERENCE 9 (bases 1 to 2128)
AUTHORS Lellek,H., Kirsten,R., Diehl,I., Apostel,F., Buck,F. and Greeve,J.
TITLE Purification and molecular cloning of a novel essential component
of the apolipoprotein B mRNA editing enzyme-complex
JOURNAL J. Biol. Chem. 275 (26), 19848-19856 (2000)
PUBMED 10781591
REFERENCE 10 (bases 1 to 2128)
AUTHORS Mehta,A., Kinter,M.T., Sherman,N.E. and Driscoll,D.M.
TITLE Molecular cloning of apobec-1 complementation factor, a novel
RNA-binding protein involved in the editing of apolipoprotein B
mRNA
JOURNAL Mol. Cell. Biol. 20 (5), 1846-1854 (2000)
PUBMED 10669759
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AF209192.1, AK000324.1 and
BG188383.1.
On Apr 30, 2002 this sequence version replaced gi:7656852.
Summary: Mammalian apolipoprotein B mRNA undergoes site-specific C
to U deamination, which is mediated by a multi-component enzyme
complex containing a minimal core composed of APOBEC-1 and a
complementation factor encoded by this gene. The gene product has
three non-identical RNA recognition motifs and belongs to the hnRNP
R family of RNA-binding proteins. It has been proposed that this
complementation factor functions as an RNA-binding subunit and
docks APOBEC-1 to deaminate the upstream cytidine. Studies suggest
that the protein may also be involved in other RNA editing or RNA
processing events. Alternative splicing occurs at this locus and
three full-length transcript variants, encoding three distinct
isoforms, have been described. Additional splicing has been
observed but the full-length nature of these variants has not been
determined. [provided by RefSeq].
Transcript Variant: This dominant variant (1), also referred to as
the wild type, encodes the shortest isoform (1).
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the
Entrez Gene record to access additional publications.
COMPLETENESS: full length.
FEATURES Location/Qualifiers
source 1..2128
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="10"
/map="10q11.23"
gene 1..2128
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
/note="APOBEC1 complementation factor"
/db_xref="GeneID:29974"
/db_xref="HGNC:24086"
/db_xref="HPRD:10627"
exon 1..95
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
/inference="alignment:Splign"
/number=1
misc_feature 3
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
/experiment="experimental evidence, no additional details
recorded"
/note="alternative transcription initiation site"
misc_feature 12
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
/experiment="experimental evidence, no additional details
recorded"
/note="alternative transcription initiation site"
exon 96..143
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
/inference="alignment:Splign"
/number=2
misc_feature 96..143
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
/note="Region: exon 2"
exon 144..287
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
/inference="alignment:Splign"
/number=3
CDS 189..1949
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
/note="isoform 1 is encoded by transcript variant 1;
APOBEC-1 stimulating protein; apo-B RNA editing protein;
apobec-1 complementation factor (ACF) (ASP);
APOBEC1-stimulating protein"
/codon_start=1
/product="APOBEC1 complementation factor isoform 1"
/protein_id="NP_055391.2"
/db_xref="GI:20357572"
/db_xref="CCDS:CCDS7241.1"
/db_xref="GeneID:29974"
/db_xref="HGNC:24086"
/db_xref="HPRD:10627"
/translation="MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPP
PGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVT
FSNKVEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVT
EGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHGIAVDWAEP
EVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNNIKPGAVERVKKIRDYAFVHFSNR
EDAVEAMKALNGKVLDGSPIEVTLAKPVDKDSYVRYTRGTGGRGTMLQGEYTYSLGQV
YDPTTTYLGAPVFYAPQTYAAIPSLHFPATKGHLSNRAIIRAPSVRGAAGVRGLGGRG
YLAYTGLGRGYQVKGDKREDKLYDILPGMELTPMNPVTLKPQGIKLAPQILEEICQKN
NWGQPVYQLHSAIGQDQRQLFLYKITIPALASQNPAIHPFTPPKLSAFVDEAKTYAAE
YTLQTLGIPTDGGDGTMATAAAAATAFPGYAVPNATAPVSAAQLKQAVTLGQDLAAYT
TYEVYPTFAVTARGDGYGTF"
misc_feature 287^288
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
/note="Region: missing exon 5"
exon 288..422
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
/inference="alignment:Splign"
/number=5
exon 423..553
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
/inference="alignment:Splign"
/number=6
exon 554..792
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
/inference="alignment:Splign"
/number=7
exon 793..957
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
/inference="alignment:Splign"
/number=8
exon 958..1055
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
/inference="alignment:Splign"
/number=9
exon 1056..1329
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
/inference="alignment:Splign"
/number=10
exon 1330..1511
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
/inference="alignment:Splign"
/number=11b
exon 1512..1648
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
/inference="alignment:Splign"
/number=12
exon 1649..1797
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
/inference="alignment:Splign"
/number=13
exon 1798..2113
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
/inference="alignment:Splign"
/number=14
STS 1798..1901
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
/standard_name="A006G44"
/db_xref="UniSTS:56372"
STS 1798..1901
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
/standard_name="G20794"
/db_xref="UniSTS:56371"
STS 1838..1959
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
/standard_name="RH70135"
/db_xref="UniSTS:478"
polyA_signal 2008..2013
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
polyA_site 2032
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
/experiment="experimental evidence, no additional details
recorded"
polyA_site 2113
/gene="A1CF"
/gene_synonym="ACF; ACF64; ACF65; APOBEC1CF; ASP;
MGC163391; RP11-564C4.2"
/experiment="experimental evidence, no additional details
recorded"
ORIGIN
1 tttgatatga cgattagagc ataacccgag tgacacgttg aattcgccat aatcaaggaa
61 accttttccg ggtggggatc tctgaaatta ctcagataac agtgctgtgc caaaaacctg
121 tggattttct ctacaaaaat tattgagcaa ccctaattaa cctgattttt tgctgataat
181 cactctcaat ggaatcaaat cacaaatccg gggatggatt gagcggcact cagaaggaag
241 cagccctccg cgcactggtc cagcgcacag gatatagctt ggtccaggaa aatggacaaa
301 gaaaatatgg tggccctcca cctggttggg atgctgcacc ccctgaaagg ggctgtgaaa
361 tttttattgg aaaacttccc cgagaccttt ttgaggatga gcttatacca ttatgtgaaa
421 aaatcggtaa aatttatgaa atgagaatga tgatggattt taatggcaac aatagaggat
481 atgcatttgt aacattttca aataaagtgg aagccaagaa tgcaatcaag caacttaata
541 attatgaaat tagaaatggg cgcctcttag gggtttgtgc cagtgtggac aactgccgat
601 tatttgttgg gggcatccca aaaaccaaaa agagagaaga aatcttatcg gagatgaaaa
661 aggttactga aggtgttgtc gatgtcatcg tctacccaag cgctgcagat aaaaccaaaa
721 accgaggctt tgccttcgtg gagtatgaga gtcatcgagc agctgccatg gcgaggagga
781 aactgctacc aggaagaatt cagttatggg gacatggtat tgcagtagac tgggcagagc
841 cagaagtaga agttgatgaa gatacaatgt cttcagtgaa aatcctatat gtaagaaatc
901 ttatgctgtc tacctctgaa gagatgattg aaaaggaatt caacaatatc aaaccaggtg
961 ctgtggagag ggtgaagaaa attcgagact atgcttttgt gcacttcagt aaccgagaag
1021 atgcagttga ggctatgaaa gctttaaatg gcaaggtgct ggatggttcc cccattgaag
1081 tcaccctagc aaaaccagtg gacaaggaca gttatgttag gtatacccga ggcacaggtg
1141 gaaggggcac catgctgcaa ggagagtata cctactcttt gggccaagtt tatgatccca
1201 ccacaaccta ccttggagct cctgtcttct atgcccccca gacctatgca gcaattccca
1261 gtcttcattt cccagccacc aaaggacatc tcagcaacag agccattatc cgagcccctt
1321 ctgttagagg ggctgcggga gtgagaggac tgggcggccg tggctatttg gcatacacag
1381 gcctgggtcg aggataccag gtcaaaggag acaaaagaga agacaaactc tatgacattt
1441 tacctgggat ggagctcacc ccaatgaatc ctgtcacatt aaaaccccaa ggaattaaac
1501 tcgctcccca gatattagaa gagatttgtc agaaaaataa ctggggacag ccagtgtacc
1561 agctgcactc tgctattgga caagaccaaa gacagctatt cttgtacaaa ataactattc
1621 ctgctctagc cagccagaat cctgcaatcc accctttcac acctccaaag ctgagtgcct
1681 ttgtggatga agcaaagacg tatgcagccg aatacaccct gcagaccctg ggcatcccca
1741 ctgatggagg cgatggcacc atggctactg ctgctgctgc tgctactgct ttcccaggat
1801 atgctgtccc taatgcaact gcacccgtgt ctgcagccca gctcaagcaa gcggtaaccc
1861 ttggacaaga cttagcagca tatacaacct atgaggtcta cccaactttt gcagtgactg
1921 cccgagggga tggatatggc accttctgaa gatgcttttt taaatttaag aataagacac
1981 acaaaactct attaaaaaaa aaaaagaaat aaacctctaa ctcggtcccc aatgatcata
2041 aataatatgt ttcctaaaga aatgcctttc cagagactgt atagcttata ccaattatag
2101 aatcatgaag taaaaaaaaa aaaaaaaa
//